PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_429583AEC.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 222aa    MW: 25106.3 Da    PI: 10.3266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_429583AEC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-165198148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT eEd++lv ++  +G g+W+  ar  g++R +k+c++rw++yl
  Traes_3DL_429583AEC.1 51 KGPWTLEEDLILVGYISHHGEGSWDNLARSAGLNRNGKSCRLRWLNYL 98
                           79********************************************97 PP

2Myb_DNA-binding52.61.1e-16104147146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ ++eEd l+ +++ +lG++ W+ Ia++++ gRt++++k++w++
  Traes_3DL_429583AEC.1 104 RGSISPEEDMLIRELHSRLGNK-WAEIAKHLP-GRTDNEVKNYWRT 147
                            7888******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1854698IPR017930Myb domain
SuperFamilySSF466898.07E-3149145IPR009057Homeodomain-like
SMARTSM007173.1E-1250100IPR001005SANT/Myb domain
PfamPF002492.5E-145198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2052104IPR009057Homeodomain-like
CDDcd001671.83E-95398No hitNo description
PROSITE profilePS5129425.27999153IPR017930Myb domain
SMARTSM007177.9E-16103151IPR001005SANT/Myb domain
PfamPF002491.2E-15104147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-24105152IPR009057Homeodomain-like
CDDcd001672.51E-12108147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
QTLVSALLSF TEDNATLGSS VPERERERER EREREKLTXX XXAAGEPAVR KGPWTLEEDL  60
ILVGYISHHG EGSWDNLARS AGLNRNGKSC RLRWLNYLRP GLRRGSISPE EDMLIRELHS  120
RLGNKWAEIA KHLPGRTDNE VKNYWRTRVH KKAPHQNQLR AQPCLATSEA TSSVSASTSH  180
ASSTVGXXXX XXXXXXXXXX XXXXXXXXXX VGDALLPVRV RR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-284715323128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12335REREREREREREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3755160.0AK375516.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3096J04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566926.23e-75PREDICTED: myb-related protein 340
SwissprotQ9LK952e-56MYB21_ARATH; Transcription factor MYB21
TrEMBLW5D9F21e-134W5D9F2_WHEAT; Uncharacterized protein
STRINGMLOC_5568.18e-84(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-56myb domain protein 21
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]